PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G177600.1.p
Common NameGLYMA_20G177600, LOC100806667
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 223aa    MW: 24062.7 Da    PI: 6.8671
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G177600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-42691681100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l
  Glyma.20G177600.1.p  69 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSEL 158
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la++++e
  Glyma.20G177600.1.p 159 QAQLAKAQAE 168
                          *****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.96468169IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-4369166IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MEYKVKTTTS TPSPPIPIHL PTMLSNSPPS SSSSPPSQSP TPFPSPSQGS PSAAPPSPPP  60
PPPPVVVSPC AACKILRRRC VEKCVLAPYF PPTDPLKFTI AHRVFGASNI IKFLQELPES  120
QRADAVSSMV YEANARIRDP VYGCAGAICQ LQKQVSELQA QLAKAQAEVV NMQCQQANLV  180
ALICMEMSQS QEQHVLQPQP HVDMSCFIED NSFGTAWEPL WT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0991130.0BT099113.1 Soybean clone JCVI-FLGm-13B15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556215.11e-160PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-78LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0B2NUM71e-160A0A0B2NUM7_GLYSO; LOB domain-containing protein 1
TrEMBLI1NHD11e-160I1NHD1_SOYBN; Uncharacterized protein
STRINGGLYMA20G31780.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-67LOB domain-containing protein 1